General Information

  • ID:  hor003086
  • Uniprot ID:  H9KRP4
  • Protein name:  Short neuropeptide F
  • Gene name:  100576163
  • Organism:  Apis mellifera (Honeybee)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  NA

Sequence Information

  • Sequence:  SPSLRLRF
  • Length:  8(75-82)
  • Propeptide:  MPIKFYLKSILLFIIVGFVVGTENYIDYSDEIPEKMPIENIQELYRLLMQRNALENARLGETPFEHLMIRKSQRSPSLRLRFGRSDPHLSILSKPMSAIPSYKFDDK
  • Signal peptide:  MPIKFYLKSILLFIIVGFVVG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-H9KRP4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003086_AF2.pdbhor003086_ESM.pdb

Physical Information

Mass: 110018 Formula: C44H74N14O11
Absent amino acids: ACDEGHIKMNQTVWY Common amino acids: LRS
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -22.5 Boman Index: -2382
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 97.5
Instability Index: 13590 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera